PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009589494.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 748aa    MW: 82611.9 Da    PI: 5.5519
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009589494.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.35.4e-1865119256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk  ++t +q+ eLe++F+ n++p+++ r eL kkl+++ +qVk+WFqNrR+++k
  XP_009589494.1  65 RKYSRHTVNQILELETAFKLNPHPNEKVRLELGKKLSMDSKQVKFWFQNRRTQMK 119
                     788899**********************************************998 PP

2START168.73.8e-532614832205
                     HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
           START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                     la++a++el+ +a+ +ep+Wv+s     e +n +e+ ++f++  +     +++ea ra+g v+ ++ +lve+l+d + +W e++     k ++++
  XP_009589494.1 261 LALAAMNELLGLAEIGEPLWVRSLdgggETLNLEEYARSFTPCTGmkpghFTTEATRATGTVIVNSLTLVETLMDMS-RWVEMFScivgKTSVVD 354
                     6899************************************99888999999**************************.***************** PP

                     EECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE CS
           START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvd 171
                     vi         + lql+++e+q +s lvp R+  f+R+++q+ +g+w++vdvSvd  q+ ++  ++  +++lpSg+++++++ng+skvtw+eh++
  XP_009589494.1 355 VIPGStcgswsSNLQLIQTEFQIISDLVPaRELKFLRFCKQHAEGVWAVVDVSVDTIQESSQAREIGNCRRLPSGCIVQDMPNGYSKVTWIEHME 449
                     **9999******************************************************99********************************* PP

                     --SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
           START 172 lkgrlphwllrslvksglaegaktwvatlqrqce 205
                     + ++++h l+r+lv++gl +ga++w+atlqrq e
  XP_009589494.1 450 YYENVVHHLYRPLVRNGLGFGAQRWMATLQRQSE 483
                     *******************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-1750121IPR009057Homeodomain-like
SuperFamilySSF466893.34E-1750120IPR009057Homeodomain-like
PROSITE profilePS5007116.76361121IPR001356Homeobox domain
SMARTSM003891.9E-1563125IPR001356Homeobox domain
CDDcd000864.85E-1565121No hitNo description
PfamPF000461.8E-1565119IPR001356Homeobox domain
PROSITE profilePS5084840.653251487IPR002913START domain
SuperFamilySSF559614.12E-30253483No hitNo description
CDDcd088752.84E-106255483No hitNo description
SMARTSM002345.4E-42260484IPR002913START domain
PfamPF018522.1E-45261482IPR002913START domain
SuperFamilySSF559612.2E-10509742No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 748 aa     Download sequence    Send to blast
MSFVKPKMES HSDMSEKGES SNNVVMGRPK EEDESESRRS NGDNLNGVAS EDEQDSALSN  60
SSKTRKYSRH TVNQILELET AFKLNPHPNE KVRLELGKKL SMDSKQVKFW FQNRRTQMKS  120
QLERHENGIL KQENDRLRIE HIAMQEAMKN PICNRCRNQA IIADINVEEH QTKIEYERLK  180
EEVKRISVLA DKLLGPLSSL EANPAFGLPE GINGFGGINY ANAASPMGLN FDNGLSSPPP  240
VISTSLANVD VSFDKSMLMD LALAAMNELL GLAEIGEPLW VRSLDGGGET LNLEEYARSF  300
TPCTGMKPGH FTTEATRATG TVIVNSLTLV ETLMDMSRWV EMFSCIVGKT SVVDVIPGST  360
CGSWSSNLQL IQTEFQIISD LVPARELKFL RFCKQHAEGV WAVVDVSVDT IQESSQAREI  420
GNCRRLPSGC IVQDMPNGYS KVTWIEHMEY YENVVHHLYR PLVRNGLGFG AQRWMATLQR  480
QSEFLAMLMS SVDTPVVCSS GQTSMAMLAQ RMTRNFCAGV CATIHKWESI QQANGEDAKL  540
MMRKNIGDPG EPIGVMLSAT KTIWLPVKQQ RLLDFLLNEQ TRSQWDILFN SGPMQQMVHI  600
AKGQNIDNSI SLFRANGNAI SDSENNMLIL QDTCTDATGS LIVYATIDAA DMDVVMNGGD  660
SSSVAFLPSG IAIVPDCFQD YSGANNCNVG TSWEKDNGFS GTGSLVTIGF QVLVTSSPAA  720
KLSMESVQKV NNLISHTIHG IKSAFKSK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009589494.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLK4BF800.0K4BF80_SOLLC; Uncharacterized protein
STRINGSolyc03g026070.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16262465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein